DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam2 and chl1b

DIOPT Version :10

Sequence 1:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b / 100318566 ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio


Alignment Length:1338 Identity:314/1338 - (23%)
Similarity:511/1338 - (38%) Gaps:293/1338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 VRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEF-- 350
            :|||...|.:.|.....|..|:..|        .|:.|.|...:.:|..|.:..........|  
Zfish     1 MRLLRKTLLLLAACLNMSSRYQTNA--------LEIPLDVLERMNMEQLPTITEYSPASLIAFPF 57

  Fly   351 ------RCLVTSNGSPVGMQNILWYKDGRQ-----------LPSSGRVEDTLVVPRVSR--ENRG 396
                  :|..|.|..|    ...|.|:|:.           |..||    |.::|....  |.:|
Zfish    58 EESFPVKCEATGNPEP----EFRWTKNGQDFDPYQDTRLITLDDSG----TFIIPNTGNLTEFQG 114

  Fly   397 MYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQP-----GPAVSLKCS-AAGNPTPQIS 455
            :|:|......|.......|..:.:.|     .|.::.:.|     |.:|.|:|: ..|.|..||.
Zfish   115 IYRCFATNKLGTAMSEEIEFIIPNVP-----KFPKEIIDPIEVMEGQSVILECNPPTGIPPLQIY 174

  Fly   456 W-TLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDG-GEYACIAENRAGRVQHAARLNIY 518
            | |:....:..:.|..:|    ::|::.    .|:.:..|. .:|.|.|                
Zfish   175 WMTISLQHIEQDERVSVG----LNGNLY----FSNTVETDSRRDYCCFA---------------- 215

  Fly   519 GLPYIRLIPKVTAVS---------------------------------------------GETLN 538
            ..|.||.|.:.||:|                                             ||.|.
Zfish   216 AFPRIRTIVQKTAMSMVVKSNKLMKDSSSGSGRGYANSLLERKPSLLAPTGMESHTRLVKGEDLQ 280

  Fly   539 LKCPVAGYPIEEIHWER-GGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARR 602
            |:|...|:|..::.|.: |..:||:  |..|:..|.|....:....|.|.|.|.|:|..|.....
Zfish   281 LECIAEGFPTPKVEWVKIGFNKLPE--RVVVESHGKLLTVEMVNEEDEGKYMCRAKNPHGEVVHH 343

  Fly   603 SGEVTVIVPP--KLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPID--PTQHMSVK 663
            . .|||..||  ::.| |:.:  :.:|....:.| ||||:...|:.||.:|||::  ||.:..:.
Zfish   344 F-HVTVEEPPEFEIEP-QSQL--VTIGADVLIKC-VVKGNPQPTVGWRVNGRPLNEVPTSNRKIL 403

  Fly   664 QVDQYNSILVIENLGSDHTGNYSCVVRNSAAEV-ENSQALLVNVPPRWIVEPVDANVE----RNR 723
            :    :..:.|.|...:::..|.|...|....: .|:..:::|:.|..:.|   .|::    ..:
Zfish   404 K----DGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLILTE---NNLQYMAVEGK 461

  Fly   724 HIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANN 788
            .:::||:....|..||.|.||..:.:.|.|.     || :..||||.:.:|.::..|.|.|.|.|
Zfish   462 SVVMHCKVFSSPASSITWSKADSANAVEGER-----FT-VHQNGSLEIHNVMKEDMGEYSCFAQN 520

  Fly   789 GIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGD----KPINIVWMRSGKNTLNP 849
            ..|. :.....|:|..........|.:.|..|.|....|....|    ....::|.:.| ..||.
Zfish   521 TEGK-VAIAATLEVKDPTRIVDPPRDLRVLAGTTIQFSCQPEFDPSFGDDFEVLWEKDG-IALNG 583

  Fly   850 STNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEA 914
            |.:.:..::     |||   |:|..|...|.|.|.|.|......|..:.||.|.:.|.||..:..
Zfish   584 SEDGRYILE-----DGV---LEIINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVPDPPEDVIL 640

  Fly   915 AMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKP 979
            :..:.|||.::|.|.......:|::::||.|:.|.  |.    .|:::......|.:|.:: |..
Zfish   641 SEHNGRSVKLQWTPGDDHNSSITEFVLEFEESQHE--PG----SWREMMRVPGNHHSAPLK-LYG 698

  Fly   980 ATRYAFRVIAEGSAGRSAPSQEL-IVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGD 1043
            ...|.|||.|....|:..|||.. ..:|....|...|.::........|:.|:| .||..:.|  
Zfish   699 HVDYRFRVSAINEVGKGRPSQSTERYKTPASAPDKNPENIKIEAHLPHEMDINW-EPLSPIEH-- 760

  Fly  1044 IQGYNVGYKLSSSGNTAYNFTSVSGDGDG-----GNGELLLSGLAKFARYTVVVQAFNQVGPGPL 1103
             .|..:.||:|        :.....|.|.     .....|:.....|..|.:.:||.|..|.||.
Zfish   761 -NGPGLEYKVS--------YRRHGSDEDWTERMVKRHSFLVKNTPTFVLYEIKIQAKNHAGWGPD 816

  Fly  1104 SEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKD 1168
            .:...|.:.||.||..|:||....|::..::|.|:.......:|.|.||::.:..:       :.
Zfish   817 PKIITAYSGEDFPSAAPDDVAVEVLNNTMVKVRWEHVHKDKIHGHLGGYRVSWWRL-------RS 874

  Fly  1169 EVESRKT----TALTM-------VLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDVPEAP 1222
            .::|:||    ..||.       |:|||:.::.||:.|:|....|:|..|..:...:.|.||...
Zfish   875 LLDSKKTHGDKHTLTFSGERNHAVVTGLKPFSEYSLIVMAFNSRGNGPGSHSVNFKTPEGVPGQA 939

  Fly  1223 ADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVNGREELNNEKRSLPSQQAYYEAKGLHPH 1287
            |.....:.....:.::|.||.:.|||:..|.|..:::|..|||.      |.......|.....|
Zfish   940 AAFSATNIQKHKVTLTWSPPVDANGVLIGYILQYQLINNTEELG------PLMTLNISADSNKQH 998

  Fly  1288 ME-------YQFWVTASTRVGEGKSSRVSSQITTNRIP----ARIISFGGPVVRPWRSTVTLPCT 1341
            :|       |:|::...||||.|.:  ||.:.||  :|    ..:.||.   :|...|..     
Zfish   999 LENLEALSKYKFYLRCCTRVGCGPA--VSEERTT--VPEATSTDVASFN---IRKSSSRF----- 1051

  Fly  1342 AVGKPKREWFKSDVALRQGGLHNSQLLDSGDLIISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQ 1406
                |.|:...|.||               :..:||:.:.   |.|..|.:       .:..|..
Zfish  1052 ----PPRKTTVSPVA---------------NATLSSIAVL---NISTSVSH-------NYANISW 1087

  Fly  1407 VPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGN---TDEMQLSRHASSHELKG 1468
            :|.       |..|.|.:                |..|.....||   :|.:..|:  :.|.::|
Zfish  1088 IPG-------TEQTESEL----------------YVAFMNNREGNWKISDMLNSSK--TFHIIEG 1127

  Fly  1469 LMCGSTYQIHLSAQNKVGTSPT-STILHVRTQGQSPGH 1505
            |..|:.|.:.|..::.|..|.. ..::..|.:|.:..|
Zfish  1128 LEPGTEYTVRLMTKSWVDNSSIFEDVIRTRAKGLASIH 1165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam2NP_001261500.1 Ig 30..128 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand E 86..90 CDD:409353
Ig strand F 106..111 CDD:409353
Ig strand G 119..123 CDD:409353
V-set 138..229 CDD:462230
Ig 238..327 CDD:472250 10/38 (26%)
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 1/4 (25%)
Ig strand G 320..323 CDD:409353 0/2 (0%)
Ig 330..418 CDD:472250 21/108 (19%)
Ig strand B 348..352 CDD:409353 1/11 (9%)
Ig strand C 365..369 CDD:409353 0/3 (0%)
Ig strand E 383..387 CDD:409353 1/3 (33%)
Ig strand F 397..402 CDD:409353 2/4 (50%)
Ig strand G 411..414 CDD:409353 0/2 (0%)
IgI_4_Dscam 422..517 CDD:409548 21/102 (21%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 0/3 (0%)
Ig strand B 438..447 CDD:409548 3/9 (33%)
Ig strand C 452..458 CDD:409548 3/6 (50%)
Ig strand C' 460..463 CDD:409548 0/2 (0%)
Ig strand D 468..476 CDD:409548 2/7 (29%)
Ig strand E 480..489 CDD:409548 0/8 (0%)
Ig strand F 496..504 CDD:409548 3/7 (43%)
Ig strand G 507..517 CDD:409548 0/9 (0%)
IgI_5_Dscam 521..608 CDD:409550 30/132 (23%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 1/3 (33%)
Ig strand B 535..542 CDD:409550 3/6 (50%)
Ig strand C 549..555 CDD:409550 1/5 (20%)
Ig strand C' 556..558 CDD:409550 1/1 (100%)
Ig strand D 565..569 CDD:409550 1/3 (33%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 4/7 (57%)
Ig strand G 598..608 CDD:409550 1/9 (11%)
Ig 611..704 CDD:472250 24/97 (25%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 0/3 (0%)
Ig strand F 684..689 CDD:409353 2/4 (50%)
Ig strand G 697..700 CDD:409353 1/2 (50%)
IgI_7_Dscam 707..802 CDD:409546 27/98 (28%)
Ig strand A 707..711 CDD:409546 1/3 (33%)
Ig strand A' 716..720 CDD:409546 1/3 (33%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 3/5 (60%)
Ig strand C' 750..753 CDD:409546 1/2 (50%)
Ig strand D 761..764 CDD:409546 1/2 (50%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 4/7 (57%)
Ig strand G 793..802 CDD:409546 1/8 (13%)
Ig 806..892 CDD:472250 22/89 (25%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 836..840 CDD:409353 0/3 (0%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 <904..1195 CDD:442628 77/307 (25%)
FN3 906..1006 CDD:238020 27/100 (27%)
fn3 1221..1306 CDD:394996 24/91 (26%)
Ig 1336..1396 CDD:409353 10/59 (17%)
Ig strand B 1336..1340 CDD:409353 0/3 (0%)
Ig strand E 1371..1375 CDD:409353 0/3 (0%)
Ig strand F 1385..1390 CDD:409353 2/4 (50%)
FN3 <1407..>1606 CDD:442628 21/103 (20%)
fn3 1408..1491 CDD:394996 18/86 (21%)
chl1bXP_017212175.2 Ig 42..135 CDD:472250 20/100 (20%)
Ig strand B 61..65 CDD:409396 0/3 (0%)
Ig strand C 74..78 CDD:409396 0/3 (0%)
Ig strand E 99..103 CDD:409396 2/7 (29%)
Ig strand F 115..120 CDD:409396 2/4 (50%)
Ig strand G 129..132 CDD:409396 0/2 (0%)
Ig 144..234 CDD:472250 26/113 (23%)
Ig strand B 158..162 CDD:409432 2/3 (67%)
Ig strand C 172..176 CDD:409432 2/3 (67%)
Ig strand E 195..199 CDD:409432 1/7 (14%)
Ig strand F 210..215 CDD:409432 2/4 (50%)
Ig strand G 226..229 CDD:409432 1/2 (50%)
Ig 267..348 CDD:472250 23/83 (28%)
Ig strand B 279..283 CDD:409394 2/3 (67%)
Ig strand C 292..296 CDD:409394 0/3 (0%)
Ig strand E 314..318 CDD:409394 1/3 (33%)
Ig strand F 328..333 CDD:409394 2/4 (50%)
Ig strand G 341..344 CDD:409394 0/2 (0%)
Ig 359..438 CDD:472250 21/85 (25%)
Ig strand B 369..373 CDD:409367 0/3 (0%)
Ig strand C 382..386 CDD:409367 1/3 (33%)
Ig strand E 406..410 CDD:409367 0/3 (0%)
Ig strand F 420..425 CDD:409367 2/4 (50%)
Ig strand G 433..436 CDD:409367 0/2 (0%)
Ig 447..533 CDD:472250 26/95 (27%)
Ig strand B 463..467 CDD:409544 0/3 (0%)
Ig strand C 476..480 CDD:409544 2/3 (67%)
Ig strand E 499..503 CDD:409544 3/3 (100%)
Ig strand F 513..518 CDD:409544 2/4 (50%)
Ig strand G 526..529 CDD:409544 0/2 (0%)
Ig 535..635 CDD:472250 27/108 (25%)
Ig strand B 554..558 CDD:409359 0/3 (0%)
Ig strand C 571..575 CDD:409359 0/3 (0%)
Ig strand E 594..598 CDD:409359 3/6 (50%)
Ig strand F 608..613 CDD:409359 2/4 (50%)
Ig strand G 621..624 CDD:409359 0/2 (0%)
FN3 632..722 CDD:238020 27/96 (28%)
FN3 <702..1101 CDD:442628 116/487 (24%)
FN3 1070..1142 CDD:214495 20/106 (19%)
Bravo_FIGEY 1196..1279 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.