| Sequence 1: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009305418.1 | Gene: | lrit3b / 100144406 | ZFINID: | ZDB-GENE-070424-130 | Length: | 487 | Species: | Danio rerio |
| Alignment Length: | 334 | Identity: | 76/334 - (22%) |
|---|---|---|---|
| Similarity: | 105/334 - (31%) | Gaps: | 131/334 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 267 PE--YSWFTHNGAGPLPV-------------LSG--------------PRVRLLG---------P 293
Fly 294 ILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNG 358
Fly 359 SP----VGMQNILWYKDGRQLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEG-----DTFQATA 414
Fly 415 E-LQLGDAP-----------PVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISW----------- 456
Fly 457 --------TLD--GFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQH 511
Fly 512 AARLNIYGL 520 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
| Ig | 138..>203 | CDD:299845 | |||
| I-set | 238..327 | CDD:254352 | 19/97 (20%) | ||
| Ig | 247..327 | CDD:299845 | 19/97 (20%) | ||
| I-set | 332..418 | CDD:254352 | 20/95 (21%) | ||
| IGc2 | 344..407 | CDD:197706 | 11/66 (17%) | ||
| IG_like | 432..517 | CDD:214653 | 31/105 (30%) | ||
| IGc2 | 436..507 | CDD:197706 | 27/91 (30%) | ||
| I-set | 521..610 | CDD:254352 | 76/334 (23%) | ||
| IGc2 | 533..597 | CDD:197706 | |||
| Ig | 630..699 | CDD:143165 | |||
| IG_like | 714..802 | CDD:214653 | |||
| Ig | 725..802 | CDD:299845 | |||
| Ig | 823..894 | CDD:143165 | |||
| FN3 | 906..1006 | CDD:238020 | |||
| FN3 | 1013..1111 | CDD:238020 | |||
| FN3 | 1119..1209 | CDD:238020 | |||
| FN3 | 1219..1313 | CDD:238020 | |||
| Ig | 1336..1402 | CDD:143165 | |||
| FN3 | 1409..1498 | CDD:238020 | |||
| FN3 | 1515..1588 | CDD:238020 | |||
| lrit3b | XP_009305418.1 | LRRNT | 51..92 | CDD:214470 | |
| leucine-rich repeat | 69..89 | CDD:275380 | |||
| LRR_8 | 112..172 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 114..137 | CDD:275378 | 5/22 (23%) | ||
| leucine-rich repeat | 138..161 | CDD:275378 | 2/22 (9%) | ||
| LRR_8 | 160..214 | CDD:290566 | 15/80 (19%) | ||
| LRR_4 | 160..201 | CDD:289563 | 14/67 (21%) | ||
| leucine-rich repeat | 162..185 | CDD:275378 | 6/34 (18%) | ||
| leucine-rich repeat | 186..199 | CDD:275378 | 5/27 (19%) | ||
| leucine-rich repeat | 215..230 | CDD:275378 | 3/14 (21%) | ||
| Ig | 278..391 | CDD:299845 | 33/115 (29%) | ||
| I-set | 279..391 | CDD:254352 | 33/114 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||