DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and ACB1

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_011551.3 Gene:ACB1 / 852925 SGDID:S000003269 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:47/86 - (54%)
Similarity:62/86 - (72%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGK 65
            |||:.|...|:.|..|..:||.||.|:||||:|||:|||||..|||:.::|.:.|||||...|||
Yeast     1 MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGK 65

  Fly    66 SSEAAQQEYITFVEGLVAKYA 86
            |.|.|::|||..|:.|:|||:
Yeast    66 SQEDAEKEYIALVDQLIAKYS 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 45/83 (54%)
ACB1NP_011551.3 ACB 1..87 CDD:226731 47/86 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342229
Domainoid 1 1.000 91 1.000 Domainoid score I1746
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39086
Inparanoid 1 1.050 102 1.000 Inparanoid score I1445
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - otm46521
orthoMCL 1 0.900 - - OOG6_101568
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 1 1.000 - - X1384
TreeFam 1 0.960 - -
1413.690

Return to query results.
Submit another query.