DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and ACBP5

DIOPT Version :10

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001331946.1 Gene:ACBP5 / 832825 AraportID:AT5G27630 Length:668 Species:Arabidopsis thaliana


Alignment Length:85 Identity:25/85 - (29%)
Similarity:41/85 - (48%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EQFNAAA---------EKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAW 59
            |:|.|||         ..||.|:.:.|:|..|.||.|.:||::|.....||...:...::||::|
plant    15 ERFYAAASYVGLDGSQSSVKQLSSKFSNDTSLLLYTLHQQATLGPCSIPKPSAWNPVEQSKWKSW 79

  Fly    60 NKQKGKSSEAAQQEYITFVE 79
            .......|..|.:.::..:|
plant    80 QGLGTMPSIEAMRLFVKILE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 25/85 (29%)
ACBP5NP_001331946.1 ACBP 15..98 CDD:459982 24/82 (29%)
NanM 182..426 CDD:442289
KELCH repeat 185..271 CDD:276965
KELCH repeat 296..343 CDD:276965
KELCH repeat 347..395 CDD:276965
KELCH repeat 398..440 CDD:276965
COG4372 549..>651 CDD:443500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.