DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and ACBP3

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001119041.1 Gene:ACBP3 / 828524 AraportID:AT4G24230 Length:366 Species:Arabidopsis thaliana


Alignment Length:81 Identity:25/81 - (30%)
Similarity:38/81 - (46%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEQFNAAAEKVKSLTKRPSDDEF-----LQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQ 62
            ||...|.|..|..|.:....:|.     ::|:.|.|.|:.|....|:|..:.:..:|||.||.|.
plant   229 SELEKAFAAAVNLLEESGKAEEIGAEAKMELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKL 293

  Fly    63 KGKSSEAAQQEYITFV 78
            ...|.|.|.::|:..|
plant   294 GNMSQEEAMEQYLALV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 25/81 (31%)
ACBP3NP_001119041.1 ACBP 232..314 CDD:279259 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.