DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and acbd7

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001165067.1 Gene:acbd7 / 779685 XenbaseID:XB-GENE-5740466 Length:88 Species:Xenopus tropicalis


Alignment Length:80 Identity:43/80 - (53%)
Similarity:55/80 - (68%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAA 70
            |:.|||.||.|..||:|:|..:||.|:||::|||.:...||:||||.||||:|||.:||.|.|.|
 Frog     7 FDKAAEDVKKLKTRPTDEELKELYGLYKQSTVGDINIDCPGMLDLKAKAKWDAWNLKKGLSKEEA 71

  Fly    71 QQEYITFVEGLVAKY 85
            ...||:....||.||
 Frog    72 MHAYISKTNELVEKY 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 43/80 (54%)
acbd7NP_001165067.1 ACBP 4..87 CDD:238248 43/80 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.