DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and Acbd6

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_082526.2 Gene:Acbd6 / 72482 MGIID:1919732 Length:282 Species:Mus musculus


Alignment Length:80 Identity:35/80 - (43%)
Similarity:45/80 - (56%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKS 66
            ::|.|..||..|:.|.:..|.::.|.|||.|||..||:.:|.||...|.:||.|||||......|
Mouse    42 LAELFEKAAAHVQGLVQVASREQLLYLYARFKQVKVGNCNTPKPNFFDFEGKQKWEAWKALGDSS 106

  Fly    67 SEAAQQEYITFVEGL 81
            ...|.||||..|:.|
Mouse   107 PSQAMQEYIAAVKKL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 35/80 (44%)
Acbd6NP_082526.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
ACBP 44..123 CDD:279259 35/78 (45%)
Acyl-CoA binding. /evidence=ECO:0000250 69..73 2/3 (67%)
ANK 165..261 CDD:238125
Ank_2 166..255 CDD:289560
ANK repeat 191..222 CDD:293786
ANK 1 191..220
ANK repeat 224..255 CDD:293786
ANK 2 224..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.