DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and Eci3

DIOPT Version :10

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_081223.1 Gene:Eci3 / 69123 MGIID:1916373 Length:317 Species:Mus musculus


Alignment Length:38 Identity:13/38 - (34%)
Similarity:19/38 - (50%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KPGLLDLKGKAKWEAWNKQKGKSSEAAQQEYITFVEGL 81
            |||:.:...||.|:|.|.......|.|::.|:..|..|
Mouse     3 KPGVFNFVNKATWDARNALGSLPKETARKNYVDLVSSL 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 13/38 (34%)
Eci3NP_081223.1 ACBP <2..37 CDD:469667 11/33 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60 1/1 (100%)
CaiD 64..309 CDD:440647
Microbody targeting signal. /evidence=ECO:0000255 315..317
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.