DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and acbd6

DIOPT Version :10

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001008065.2 Gene:acbd6 / 493427 XenbaseID:XB-GENE-989234 Length:286 Species:Xenopus tropicalis


Alignment Length:77 Identity:33/77 - (42%)
Similarity:43/77 - (55%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEA 69
            ||..||:.|::.....|.::.|.|||.:||..||..:|.|||..|.:||.|||||......|.:.
 Frog    35 QFEQAAKHVQNGASVASTEQLLFLYARYKQVKVGRCNTPKPGFFDYEGKKKWEAWKALGDYSCQQ 99

  Fly    70 AQQEYITFVEGL 81
            |..|||..|:.|
 Frog   100 AMNEYIETVKKL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 33/77 (43%)
acbd6NP_001008065.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
ACBP 35..108 CDD:459982 31/72 (43%)
ANKYR <157..278 CDD:440430
ANK repeat 182..213 CDD:293786
ANK 1 182..211
ANK repeat 215..246 CDD:293786
ANK 2 215..244
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.