DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and dbi

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_988874.1 Gene:dbi / 394469 XenbaseID:XB-GENE-6453954 Length:87 Species:Xenopus tropicalis


Alignment Length:85 Identity:48/85 - (56%)
Similarity:65/85 - (76%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGK 65
            |..|.|:.|||:||.|...|:|:|.|:.|||:|||:|||.|||:||:||.||||||::|.|::|.
 Frog     1 MSQEAFDKAAEEVKQLKSTPTDEEMLETYALYKQATVGDVDTARPGMLDFKGKAKWDSWKKKEGT 65

  Fly    66 SSEAAQQEYITFVEGLVAKY 85
            |.|.|:.:|:.:||.|.|||
 Frog    66 SKEDARAQYVDWVEKLKAKY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 47/84 (56%)
dbiNP_988874.1 ACBP 2..86 CDD:412233 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6997
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4799
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - oto103002
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.