DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and dbi

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_955902.1 Gene:dbi / 393831 ZFINID:ZDB-GENE-040426-1861 Length:87 Species:Danio rerio


Alignment Length:85 Identity:45/85 - (52%)
Similarity:61/85 - (71%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGK 65
            |...:|..|||:||.|..:|:|.|.|::|:|:|||:|||.:||:||:||..|||||:||:.:||.
Zfish     1 MSEAEFQKAAEEVKQLKAKPTDAEMLEIYSLYKQATVGDVNTARPGMLDFTGKAKWDAWDAKKGT 65

  Fly    66 SSEAAQQEYITFVEGLVAKY 85
            |.|.|.:.||..||.|..||
Zfish    66 SKEDAVKAYIAKVEELKGKY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 44/84 (52%)
dbiNP_955902.1 ACBP 2..86 CDD:294152 44/84 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39086
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101568
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.690

Return to query results.
Submit another query.