DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and anox

DIOPT Version :10

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:80 Identity:28/80 - (35%)
Similarity:40/80 - (50%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKS 66
            |.|.|:.|.|.|...:......:.|..|..:|||:.|......||||.|:.|:||:||......|
  Fly     9 VDELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMS 73

  Fly    67 SEAAQQEYITFVEGL 81
            ..||:|.|:..::.|
  Fly    74 QSAARQAYVQKLQEL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 28/80 (35%)
anoxNP_001027085.1 ACBP 10..85 CDD:459982 26/74 (35%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.