DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and Acbd7

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001119551.1 Gene:Acbd7 / 361277 RGDID:1564164 Length:89 Species:Rattus norvegicus


Alignment Length:81 Identity:43/81 - (53%)
Similarity:54/81 - (66%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGD-NDTAKPGLLDLKGKAKWEAWNKQKGKSSEA 69
            |:.||:.|:.|..||.|:|..:||.|:||:.:|| |..|.|.:|||||||||||||.|||.|.|.
  Rat     7 FDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIGACPAMLDLKGKAKWEAWNLQKGLSKED 71

  Fly    70 AQQEYITFVEGLVAKY 85
            |...||:....|:.||
  Rat    72 AMGAYISKARELIEKY 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 43/81 (53%)
Acbd7NP_001119551.1 ACBP 3..88 CDD:294152 43/81 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - mtm8941
orthoMCL 1 0.900 - - OOG6_101568
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.