DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and CG8814

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_608729.1 Gene:CG8814 / 33492 FlyBaseID:FBgn0031478 Length:324 Species:Drosophila melanogaster


Alignment Length:86 Identity:34/86 - (39%)
Similarity:49/86 - (56%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSEQFNAAAEKVKSLTK----RPSDDEFLQLYALFKQASVGDNDT-AKPGLLDLKGKAKWEAWNK 61
            :.|:|.||...:|.|.|    :||....|:.|.|||||:.|..|. .|||..|:.|||||:|||.
  Fly     4 IEERFQAAVNVIKGLPKNGPYQPSTSMMLKFYGLFKQATEGRPDVDKKPGFWDIVGKAKWQAWND 68

  Fly    62 QKGKSSEAAQQEYITFVEGLV 82
            .:..:.|.|.|.|:..::.::
  Fly    69 NRHLTKEEAMQRYVESLQEII 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 34/86 (40%)
CG8814NP_608729.1 ACBP 5..90 CDD:279259 34/85 (40%)
DUF1664 <217..272 CDD:285172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.