DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and acbp-5

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_499817.2 Gene:acbp-5 / 176800 WormBaseID:WBGene00011731 Length:274 Species:Caenorhabditis elegans


Alignment Length:75 Identity:18/75 - (24%)
Similarity:33/75 - (44%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAK-PGLLDLKGKAKWEAWNKQKG 64
            ::..:|:||..::.....:......|:.|.|:|||..|..|:.| |...:...:.|:.:|.....
 Worm    27 LLEAKFDAATTRLPGFLTKIDQKTILKFYGLYKQAVEGPADSKKGPYWFETVARKKFNSWLANSQ 91

  Fly    65 KSSEAAQQEY 74
            .|...|.:.|
 Worm    92 MSRSRAMEAY 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 18/74 (24%)
acbp-5NP_499817.2 ACBP 29..108 CDD:279259 18/73 (25%)
Ank_2 160..253 CDD:289560
ANK 161..272 CDD:238125
ANK repeat 188..220 CDD:293786
ANK repeat 222..253 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.