DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and ech-4

DIOPT Version :10

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001366707.1 Gene:ech-4 / 174665 WormBaseID:WBGene00001153 Length:385 Species:Caenorhabditis elegans


Alignment Length:81 Identity:34/81 - (41%)
Similarity:53/81 - (65%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAA 70
            |..|.:.:|:|.:.|.:|..||||.|||||:.||....:||::|..|:||::|||..||::.:.|
 Worm    29 FEKAQKNLKTLKEEPDNDVKLQLYGLFKQATAGDVQGKRPGMMDFVGRAKYDAWNTLKGQTQDEA 93

  Fly    71 QQEYITFVEGLVAKYA 86
            :..|...|.||:::.|
 Worm    94 RANYAKLVGGLISEEA 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 33/79 (42%)
ech-4NP_001366707.1 ACBP 25..109 CDD:238248 33/79 (42%)
CaiD 129..381 CDD:440647
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.