DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and DBI

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001171488.1 Gene:DBI / 1622 HGNCID:2690 Length:148 Species:Homo sapiens


Alignment Length:81 Identity:43/81 - (53%)
Similarity:57/81 - (70%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEA 69
            :|..|||:|:.|..:|||:|.|.:|..:|||:|||.:|.:||:||..|||||:|||:.||.|.|.
Human    66 EFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKED 130

  Fly    70 AQQEYITFVEGLVAKY 85
            |.:.||..||.|..||
Human   131 AMKAYINKVEELKKKY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 43/81 (53%)
DBINP_001171488.1 ACBP 74..147 CDD:238248 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155542
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39086
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101568
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.690

Return to query results.
Submit another query.