DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp2 and acbd5b

DIOPT Version :9

Sequence 1:NP_523952.2 Gene:Acbp2 / 38784 FlyBaseID:FBgn0010387 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_005171195.1 Gene:acbd5b / 100004736 ZFINID:ZDB-GENE-070705-18 Length:425 Species:Danio rerio


Alignment Length:83 Identity:29/83 - (34%)
Similarity:46/83 - (55%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EQFNAAAEKVKSLTKRP----SDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKG 64
            ::|.||.:.::||.:..    |||..:..|:.:|||:.|..:|.||...|..||||||||.....
Zfish    14 KRFEAAVKVIRSLPEDGSYDLSDDMLVLFYSYYKQATEGPCNTLKPNSWDPIGKAKWEAWKDLGN 78

  Fly    65 KSSEAAQQEYITFVEGLV 82
            .|.:.|..||:..::.::
Zfish    79 MSKDQAMTEYVQEIQLII 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp2NP_523952.2 ACBP 2..86 CDD:238248 29/83 (35%)
acbd5bXP_005171195.1 ACBP 13..97 CDD:279259 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.