DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and ACBD5

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_054223100.1 Gene:ACBD5 / 91452 HGNCID:23338 Length:600 Species:Homo sapiens


Alignment Length:79 Identity:28/79 - (35%)
Similarity:43/79 - (54%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTK----KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLS 64
            ||.|.::.....|    :||:...|:||..:||||.|...:.:||......:.|::||||...::
Human   111 FEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMT 175

  Fly    65 KEAAKEAYVKVYEK 78
            ||.|..|||:..:|
Human   176 KEEAMIAYVEEMKK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 28/79 (35%)
ACBD5XP_054223100.1 ACBP 107..195 CDD:238248 28/79 (35%)

Return to query results.
Submit another query.