DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and ACBP5

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001331946.1 Gene:ACBP5 / 832825 AraportID:AT5G27630 Length:668 Species:Arabidopsis thaliana


Alignment Length:73 Identity:22/73 - (30%)
Similarity:39/73 - (53%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYV 73
            :|::||:   .|...| .|.|.:|||:|..:|.||.|....:::|:::|.....:....|...:|
plant    35 QLSSKFS---NDTSLL-LYTLHQQATLGPCSIPKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFV 95

  Fly    74 KVYEKYAP 81
            |:.|:..|
plant    96 KILEEADP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 22/73 (30%)
ACBP5NP_001331946.1 ACBP 15..98 CDD:459982 20/66 (30%)
NanM 182..426 CDD:442289
KELCH repeat 185..271 CDD:276965
KELCH repeat 296..343 CDD:276965
KELCH repeat 347..395 CDD:276965
KELCH repeat 398..440 CDD:276965
COG4372 549..>651 CDD:443500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.