powered by:
Protein Alignment Acbp3 and ACBP3
DIOPT Version :9
Sequence 1: | NP_001163366.1 |
Gene: | Acbp3 / 38783 |
FlyBaseID: | FBgn0250836 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001119041.1 |
Gene: | ACBP3 / 828524 |
AraportID: | AT4G24230 |
Length: | 366 |
Species: | Arabidopsis thaliana |
Alignment Length: | 58 |
Identity: | 20/58 - (34%) |
Similarity: | 31/58 - (53%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 LEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAP 81
:|.:||.|.||.|.....:|.|:.:..:||:.||.....:|:|.|.|.|:.:..|..|
plant 257 MELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSKEIP 314
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp3 | NP_001163366.1 |
ACBP |
4..84 |
CDD:294152 |
20/58 (34%) |
ACBP3 | NP_001119041.1 |
ACBP |
232..314 |
CDD:279259 |
19/56 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.770 |
|
Return to query results.
Submit another query.