DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Eci3

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_081223.1 Gene:Eci3 / 69123 MGIID:1916373 Length:317 Species:Mus musculus


Alignment Length:32 Identity:12/32 - (37%)
Similarity:19/32 - (59%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KPGALALKDKAKYEAWSSNKGLSKEAAKEAYV 73
            |||.....:||.::|.::...|.||.|::.||
Mouse     3 KPGVFNFVNKATWDARNALGSLPKETARKNYV 34

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 12/32 (38%)
Eci3NP_081223.1 ACBP <2..37 CDD:469667 12/32 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60
CaiD 64..309 CDD:440647
Microbody targeting signal. /evidence=ECO:0000255 315..317
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.