DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Dbil5

DIOPT Version :9

Sequence 1:NP_001163366.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_067607.1 Gene:Dbil5 / 59116 RGDID:68360 Length:87 Species:Rattus norvegicus


Alignment Length:77 Identity:35/77 - (45%)
Similarity:42/77 - (54%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKE 66
            |.||.|.....:.....:|.|.|..|..:||||.||.||..|.|..:|.|||:|||..|||:||.
  Rat     4 VEFEMACASLKQLKGPLSDQEKLLVYSFYKQATQGDCNIPVPPATDVKAKAKWEAWMVNKGMSKM 68

  Fly    67 AAKEAYV-KVYE 77
            .|...|: ||.|
  Rat    69 DAMRIYIAKVEE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 34/75 (45%)
Dbil5NP_067607.1 ACBP 2..85 CDD:238248 35/77 (45%)
Acyl-CoA binding. /evidence=ECO:0000250 29..33 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.