DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and acbd5a

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_009295513.1 Gene:acbd5a / 553674 ZFINID:ZDB-GENE-050522-268 Length:513 Species:Danio rerio


Alignment Length:57 Identity:26/57 - (45%)
Similarity:34/57 - (59%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYV 73
            :|:....|:||..:||||.|..||.:||......|||::||||...:.||.|..|||
Zfish    31 QPSHDMMLKFYSYYKQATQGPCNIPRPGFWDPVGKAKWDAWSSLGEMPKEEAMAAYV 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 26/57 (46%)
acbd5aXP_009295513.1 ACBP 11..98 CDD:238248 26/57 (46%)

Return to query results.
Submit another query.