DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and eci2

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001002645.4 Gene:eci2 / 436918 ZFINID:ZDB-GENE-040718-392 Length:392 Species:Danio rerio


Alignment Length:70 Identity:29/70 - (41%)
Similarity:40/70 - (57%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            |.:|.:..|...|.|.:...|:.|.||||||||..|..|||.|...:|.|::||.....:|:|.|
Zfish    43 FNKAKDKLNTLKKDPGNEVKLKIYALFKQATVGPCNTPKPGMLDFVNKVKWDAWKGLGSISQEDA 107

  Fly    69 KEAYV 73
            ::.||
Zfish   108 RQQYV 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 29/70 (41%)
eci2NP_001002645.4 None

Return to query results.
Submit another query.