DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and acbd4

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_998260.1 Gene:acbd4 / 406368 ZFINID:ZDB-GENE-040426-2074 Length:403 Species:Danio rerio


Alignment Length:81 Identity:30/81 - (37%)
Similarity:42/81 - (51%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTK----KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLS 64
            |:.|.::.....|    ||:....|.||||||||..|...:.:||......:.|:||||:...:|
Zfish    16 FQAAVDVIQSLPKNGTYKPSYEVMLRFYGLFKQAVCGPCTLSRPGFWDPVGRYKWEAWSNLGEMS 80

  Fly    65 KEAAKEAYVKVYEKYA 80
            :|.|..|||...:|.|
Zfish    81 RETAMAAYVDEMKKVA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 30/81 (37%)
acbd4NP_998260.1 ACBP 13..90 CDD:459982 27/73 (37%)

Return to query results.
Submit another query.