DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Acbp6

DIOPT Version :9

Sequence 1:NP_001163366.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster


Alignment Length:86 Identity:45/86 - (52%)
Similarity:57/86 - (66%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKD---KAKYEAWSSNKG 62
            |.:|||..|.|..|...|:..|||||||.:|||||||.|||:|     :|   ||:|.||.|..|
  Fly     1 MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEP-----EDEEKKARYNAWKSKAG 60

  Fly    63 LSKEAAKEAYVKVYEKYAPKY 83
            |:.:.||..|::||:||||:|
  Fly    61 LTADDAKAYYIEVYKKYAPQY 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 44/83 (53%)
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D148937at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10534
65.850

Return to query results.
Submit another query.