powered by:
Protein Alignment Acbp3 and Acbp1
DIOPT Version :9
Sequence 1: | NP_001163366.1 |
Gene: | Acbp3 / 38783 |
FlyBaseID: | FBgn0250836 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285744.1 |
Gene: | Acbp1 / 34111 |
FlyBaseID: | FBgn0031992 |
Length: | 90 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 34/70 - (48%) |
Similarity: | 44/70 - (62%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
|.:|.|........|.|.:.||.|.|:|||||||.|.:|||.|..|.|||:|||::.||:|...|
Fly 7 FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDA 71
Fly 69 KEAYV 73
:.||:
Fly 72 QAAYI 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp3 | NP_001163366.1 |
ACBP |
4..84 |
CDD:294152 |
34/70 (49%) |
Acbp1 | NP_001285744.1 |
ACBP |
5..87 |
CDD:238248 |
34/70 (49%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D131319at33392 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001211 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101568 |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23310 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.820 |
|
Return to query results.
Submit another query.