DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Acbd4

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001427113.1 Gene:Acbd4 / 303577 RGDID:1308404 Length:329 Species:Rattus norvegicus


Alignment Length:83 Identity:26/83 - (31%)
Similarity:41/83 - (49%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTK----KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLS 64
            |:.|..:.....|    :|:..|.|.||..:||||.|...:.:||......:.|::||:|...:|
  Rat    14 FQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATAGPCLVPRPGFWDPIGRYKWDAWNSLGKMS 78

  Fly    65 KEAAKEAYVKVYEKYAPK 82
            :|.|..||:...:..|.|
  Rat    79 REEAMSAYITEMKLVAQK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 26/83 (31%)
Acbd4NP_001427113.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..170
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.