DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Eci2

DIOPT Version :9

Sequence 1:NP_001163366.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:70 Identity:27/70 - (38%)
Similarity:37/70 - (52%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            ||.|........|.|.:...|..|.|:||||.|...:.|||.....:|||::||::...|.||.|
  Rat    41 FENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKETA 105

  Fly    69 KEAYV 73
            ::.||
  Rat   106 RQNYV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 27/70 (39%)
Eci2NP_001006967.1 ACBP 38..113 CDD:279259 27/70 (39%)
Acyl-CoA binding. /evidence=ECO:0000250 64..68 2/3 (67%)
crotonase-like 134..389 CDD:304874
ECH-like 149..319
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.