DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and acbp-6

DIOPT Version :9

Sequence 1:NP_001163366.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_496552.1 Gene:acbp-6 / 189453 WormBaseID:WBGene00012457 Length:115 Species:Caenorhabditis elegans


Alignment Length:85 Identity:31/85 - (36%)
Similarity:44/85 - (51%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKD---KAKYEAWSSNKGL 63
            ::||.|.|...:...:|||.|.|:.|.|:|||..||:..|....:...|   :.||.||.|.||.
 Worm    13 LTFEIAAEEMRRLKSEPTDRERLKLYALYKQALHGDIPNEDVYPVPAGDEVGRKKYAAWKSQKGA 77

  Fly    64 SKEAAKEAYVKVYEKYAPKY 83
            :.|..:..||.:.|:...||
 Worm    78 NSEKCRADYVAIAEEMIKKY 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_001163366.1 ACBP 4..84 CDD:294152 31/83 (37%)
acbp-6NP_496552.1 ACBP 15..95 CDD:376410 29/79 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.