DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and acbp-3

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_509822.2 Gene:acbp-3 / 181281 WormBaseID:WBGene00009818 Length:116 Species:Caenorhabditis elegans


Alignment Length:85 Identity:30/85 - (35%)
Similarity:54/85 - (63%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTK----KPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLS 64
            |:.|.|:..|..|    ..::.:.|.||.|||||::||||.::||..::.::.|:::|...:|:|
 Worm     7 FDAAVEIIQKLPKTGPVATSNDQKLTFYSLFKQASIGDVNTDRPGIFSIIERKKWDSWKELEGVS 71

  Fly    65 KEAAKEAYVK----VYEKYA 80
            ::.|||.|:|    :::|.|
 Worm    72 QDEAKERYIKALNDMFDKIA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 30/85 (35%)
acbp-3NP_509822.2 ACBP 3..91 CDD:238248 29/83 (35%)

Return to query results.
Submit another query.