DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and DBI

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001171488.1 Gene:DBI / 1622 HGNCID:2690 Length:148 Species:Homo sapiens


Alignment Length:80 Identity:39/80 - (48%)
Similarity:50/80 - (62%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            ||:|.|.......||:|.|.|..||.:|||||||:|.|:||.|....|||::||:..||.|||.|
Human    67 FEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDA 131

  Fly    69 KEAYVKVYEKYAPKY 83
            .:||:...|:...||
Human   132 MKAYINKVEELKKKY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 39/80 (49%)
DBINP_001171488.1 ACBP 74..147 CDD:238248 35/73 (48%)

Return to query results.
Submit another query.