DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp3 and Dbi

DIOPT Version :10

Sequence 1:NP_648083.1 Gene:Acbp3 / 38783 FlyBaseID:FBgn0250836 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001033088.1 Gene:Dbi / 13167 MGIID:94865 Length:135 Species:Mus musculus


Alignment Length:80 Identity:38/80 - (47%)
Similarity:53/80 - (66%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
            |::|.|...:...:|||.|.|..|..||||||||||.::||.|.||.|||:::|:..||.|||:|
Mouse    54 FDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESA 118

  Fly    69 KEAYVKVYEKYAPKY 83
            .:.||:..::...||
Mouse   119 MKTYVEKVDELKKKY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp3NP_648083.1 ACBP 4..84 CDD:469667 38/80 (48%)
DbiNP_001033088.1 ACBP 52..134 CDD:238248 38/80 (48%)

Return to query results.
Submit another query.