powered by:
Protein Alignment Acbp3 and eci2
DIOPT Version :9
Sequence 1: | NP_001163366.1 |
Gene: | Acbp3 / 38783 |
FlyBaseID: | FBgn0250836 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012819853.2 |
Gene: | eci2 / 100216270 |
XenbaseID: | XB-GENE-961246 |
Length: | 413 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 28/72 - (38%) |
Similarity: | 41/72 - (56%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAA 68
||:|..........|.:...|:.|.||||||.|..|:.|||.|...:|.|::||.|...|.|:.|
Frog 63 FEKAQSNLKLLKNDPGNEVKLKLYALFKQATQGPCNVPKPGMLDFVNKVKWDAWKSLGSLPKDDA 127
Fly 69 KEAYVKV 75
:::||::
Frog 128 RQSYVEL 134
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp3 | NP_001163366.1 |
ACBP |
4..84 |
CDD:294152 |
28/72 (39%) |
eci2 | XP_012819853.2 |
ACBP |
60..131 |
CDD:412233 |
26/67 (39%) |
crotonase-like |
161..411 |
CDD:419961 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.