DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and ACB1

DIOPT Version :9

Sequence 1:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_011551.3 Gene:ACB1 / 852925 SGDID:S000003269 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:32/78 - (41%)
Similarity:44/78 - (56%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKAKNFKNLPSK---EEFLEFYGYYKQATVGDCNIEEPEDEEKKARY--NAWKSKAGLTADDAKA 68
            ||||....||:|   :|.||.|..||||||||.:.|:|.....|.||  .||::..|.:.:||:.
Yeast     8 EKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEK 72

  Fly    69 YYIEVYKKYAPQY 81
            .||.:..:...:|
Yeast    73 EYIALVDQLIAKY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 31/74 (42%)
ACB1NP_011551.3 ACB 1..87 CDD:226731 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.