DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and ACBP6

DIOPT Version :10

Sequence 1:NP_648082.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_174462.1 Gene:ACBP6 / 840069 AraportID:AT1G31812 Length:92 Species:Arabidopsis thaliana


Alignment Length:75 Identity:27/75 - (36%)
Similarity:41/75 - (54%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66
            |||..||......|||.|:.|..||.||||..|..:...|.  ..:::|:::|||:..|.::::|
plant     7 FEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEA 71

  Fly    67 KAYYIEVYKK 76
            ...||...|:
plant    72 MNDYITKVKQ 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_648082.1 ACBP 4..73 CDD:459982 26/70 (37%)
ACBP6NP_174462.1 ACBP 3..87 CDD:238248 27/75 (36%)

Return to query results.
Submit another query.