DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and ACBP5

DIOPT Version :10

Sequence 1:NP_648082.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001331946.1 Gene:ACBP5 / 832825 AraportID:AT5G27630 Length:668 Species:Arabidopsis thaliana


Alignment Length:70 Identity:16/70 - (22%)
Similarity:39/70 - (55%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KNLPSK---EEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDAKAYYIEVY 74
            |.|.||   :..|..|..::|||:|.|:|.:|.  :..:::::.:|:....:.:.:|...::::.
plant    34 KQLSSKFSNDTSLLLYTLHQQATLGPCSIPKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFVKIL 98

  Fly    75 KKYAP 79
            ::..|
plant    99 EEADP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_648082.1 ACBP 4..73 CDD:459982 15/62 (24%)
ACBP5NP_001331946.1 ACBP 15..98 CDD:459982 15/63 (24%)
NanM 182..426 CDD:442289
KELCH repeat 185..271 CDD:276965
KELCH repeat 296..343 CDD:276965
KELCH repeat 347..395 CDD:276965
KELCH repeat 398..440 CDD:276965
COG4372 549..>651 CDD:443500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.