DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and ACBP3

DIOPT Version :9

Sequence 1:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001119041.1 Gene:ACBP3 / 828524 AraportID:AT4G24230 Length:366 Species:Arabidopsis thaliana


Alignment Length:77 Identity:21/77 - (27%)
Similarity:36/77 - (46%) Gaps:13/77 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDE--EKKARYNAWKSKAGLTADDAK 67
            |||..:||           :|.:|.:|.||.|.|...:|...  ..:|::|||:....::.::|.
plant   249 EEIGAEAK-----------MELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAM 302

  Fly    68 AYYIEVYKKYAP 79
            ..|:.:..|..|
plant   303 EQYLALVSKEIP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 20/75 (27%)
ACBP3NP_001119041.1 ACBP 232..314 CDD:279259 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.