DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and ACBD4

DIOPT Version :9

Sequence 1:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_016880573.1 Gene:ACBD4 / 79777 HGNCID:23337 Length:348 Species:Homo sapiens


Alignment Length:69 Identity:27/69 - (39%)
Similarity:38/69 - (55%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDAKAYYIEVY 74
            ||....||.||.|.||.||||||:|.|.:..|.  |...:.:::||.|...::.::|.:.||...
Human    28 KNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEM 92

  Fly    75 KKYA 78
            |..|
Human    93 KLVA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 27/69 (39%)
ACBD4XP_016880573.1 ACBP 13..93 CDD:376410 25/64 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.