powered by:
Protein Alignment Acbp6 and ACBD4
DIOPT Version :9
Sequence 1: | NP_001286963.1 |
Gene: | Acbp6 / 38782 |
FlyBaseID: | FBgn0035743 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016880573.1 |
Gene: | ACBD4 / 79777 |
HGNCID: | 23337 |
Length: | 348 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 27/69 - (39%) |
Similarity: | 38/69 - (55%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 KNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDAKAYYIEVY 74
||....||.||.|.||.||||||:|.|.:..|. |...:.:::||.|...::.::|.:.||...
Human 28 KNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEM 92
Fly 75 KKYA 78
|..|
Human 93 KLVA 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp6 | NP_001286963.1 |
ACBP |
4..79 |
CDD:395715 |
27/69 (39%) |
ACBD4 | XP_016880573.1 |
ACBP |
13..93 |
CDD:376410 |
25/64 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.