DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acbp6 and Acbd6

DIOPT Version :9

Sequence 1:	NP_001286963.1	Gene:	Acbp6 / 38782	FlyBaseID:	FBgn0035743	Length:	82	Species:	Drosophila melanogaster
Sequence 2:	NP_082526.2	Gene:	Acbd6 / 72482	MGIID:	1919732	Length:	282	Species:	Mus musculus

Alignment Length:	78	Identity:	25/78 - (32%)
Similarity:	37/78 - (47%)	Gaps:	2/78 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66
            ||:.....:....:.|:|:.|..|..:||..||:||..:|.  |.|.|.::.|||:....:...|
Mouse    46 FEKAAAHVQGLVQVASREQLLYLYARFKQVKVGNCNTPKPNFFDFEGKQKWEAWKALGDSSPSQA 110

  Fly    67 KAYYIEVYKKYAP 79
            ...||...||..|
Mouse   111 MQEYIAAVKKLDP 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acbp6	NP_001286963.1	ACBP	4..79	CDD:395715	24/76 (32%)
Acbd6	NP_082526.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..39
		ACBP	44..123	CDD:279259	24/76 (32%)
		Acyl-CoA binding. /evidence=ECO:0000250	69..73		1/3 (33%)
		ANK	165..261	CDD:238125
		Ank_2	166..255	CDD:289560
		ANK repeat	191..222	CDD:293786
		ANK 1	191..220
		ANK repeat	224..255	CDD:293786
		ANK 2	224..253
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4281
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810