powered by:
Protein Alignment Acbp6 and eci2
DIOPT Version :9
Sequence 1: | NP_001286963.1 |
Gene: | Acbp6 / 38782 |
FlyBaseID: | FBgn0035743 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002645.3 |
Gene: | eci2 / 436918 |
ZFINID: | ZDB-GENE-040718-392 |
Length: | 392 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 39/72 - (54%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66
|.:..:|....|..|..|..|:.|..:||||||.||..:|. |...|.:::|||....::.::|
Zfish 43 FNKAKDKLNTLKKDPGNEVKLKIYALFKQATVGPCNTPKPGMLDFVNKVKWDAWKGLGSISQEEA 107
Fly 67 KAYYIEV 73
:..|:::
Zfish 108 RQQYVDL 114
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp6 | NP_001286963.1 |
ACBP |
4..79 |
CDD:395715 |
23/72 (32%) |
eci2 | NP_001002645.3 |
ACBP |
39..123 |
CDD:238248 |
23/72 (32%) |
crotonase-like |
140..387 |
CDD:329030 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.