powered by:
Protein Alignment Acbp6 and dbi
DIOPT Version :9
Sequence 1: | NP_001286963.1 |
Gene: | Acbp6 / 38782 |
FlyBaseID: | FBgn0035743 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_955902.1 |
Gene: | dbi / 393831 |
ZFINID: | ZDB-GENE-040426-1861 |
Length: | 87 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 32/73 - (43%) |
Similarity: | 43/73 - (58%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66
|::..|:.|..|..|:..|.||.|..||||||||.|...|. |...||:::||.:|.|.:.:||
Zfish 6 FQKAAEEVKQLKAKPTDAEMLEIYSLYKQATVGDVNTARPGMLDFTGKAKWDAWDAKKGTSKEDA 70
Fly 67 -KAYYIEV 73
|||..:|
Zfish 71 VKAYIAKV 78
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp6 | NP_001286963.1 |
ACBP |
4..79 |
CDD:395715 |
32/73 (44%) |
dbi | NP_955902.1 |
ACBP |
2..86 |
CDD:294152 |
32/73 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG63566 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1588000at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23310 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.930 |
|
Return to query results.
Submit another query.