DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and acbp-7

DIOPT Version :10

Sequence 1:NP_648082.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001379780.1 Gene:acbp-7 / 3896747 WormBaseID:WBGene00044603 Length:134 Species:Caenorhabditis elegans


Alignment Length:77 Identity:23/77 - (29%)
Similarity:37/77 - (48%) Gaps:21/77 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEFLEF-------YGYYKQATVGDCNIEEPE----DEEKKA----------RYNAWKSKAGLTAD 64
            |.|.:|       :|.|:||.|||.|:.:..    ||.:|:          :::||....|||.:
 Worm    26 ELFTKFENHTRHVWGLYQQAIVGDVNVPKLNYMEIDEGEKSWMWRWINGNEKWHAWNKCRGLTKE 90

  Fly    65 DAKAYYIEVYKK 76
            :|...|:|..:|
 Worm    91 EASEQYVEAVQK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_648082.1 ACBP 4..73 CDD:459982 21/72 (29%)
acbp-7NP_001379780.1 ACBP <40..100 CDD:459982 19/59 (32%)

Return to query results.
Submit another query.