DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and Acbd4

DIOPT Version :10

Sequence 1:NP_648082.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001427113.1 Gene:Acbd4 / 303577 RGDID:1308404 Length:329 Species:Rattus norvegicus


Alignment Length:69 Identity:27/69 - (39%)
Similarity:37/69 - (53%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDAKAYYIEVY 74
            ||....||.||.|.||.||||||.|.|.:..|.  |...:.:::||.|...::.::|.:.||...
  Rat    26 KNGSYRPSYEEMLRFYSYYKQATAGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEM 90

  Fly    75 KKYA 78
            |..|
  Rat    91 KLVA 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_648082.1 ACBP 4..73 CDD:459982 25/62 (40%)
Acbd4NP_001427113.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..170
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.