powered by:
Protein Alignment Acbp6 and acbp-4
DIOPT Version :9
Sequence 1: | NP_001286963.1 |
Gene: | Acbp6 / 38782 |
FlyBaseID: | FBgn0035743 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498609.1 |
Gene: | acbp-4 / 186372 |
WormBaseID: | WBGene00018949 |
Length: | 146 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 37/73 - (50%) |
Gaps: | 5/73 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 KNLPSK---EEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDAKAYYIEVY 74
||.|.| .:.|:.|..|||||.|.|:..:|. ..|::.::|||.....:...:|||.|:|..
Worm 21 KNGPIKTSINDQLQMYSLYKQATSGKCDTIQPYFFQIEQRMKWNAWNQLGNMDEAEAKAQYVEKM 85
Fly 75 KKYAPQYE 82
.|...|.|
Worm 86 LKLCNQAE 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp6 | NP_001286963.1 |
ACBP |
4..79 |
CDD:395715 |
24/68 (35%) |
acbp-4 | NP_498609.1 |
ACBP |
5..93 |
CDD:238248 |
25/71 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG63566 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.780 |
|
Return to query results.
Submit another query.