powered by:
Protein Alignment Acbp6 and ech-4
DIOPT Version :9
Sequence 1: | NP_001286963.1 |
Gene: | Acbp6 / 38782 |
FlyBaseID: | FBgn0035743 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366707.1 |
Gene: | ech-4 / 174665 |
WormBaseID: | WBGene00001153 |
Length: | 385 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 40/72 - (55%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEP--EDEEKKARYNAWKSKAGLTADDA 66
||:..:..|..|..|..:..|:.||.:||||.||...:.| .|...:|:|:||.:..|.|.|:|
Worm 29 FEKAQKNLKTLKEEPDNDVKLQLYGLFKQATAGDVQGKRPGMMDFVGRAKYDAWNTLKGQTQDEA 93
Fly 67 KAYYIEV 73
:|.|.::
Worm 94 RANYAKL 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp6 | NP_001286963.1 |
ACBP |
4..79 |
CDD:395715 |
26/72 (36%) |
ech-4 | NP_001366707.1 |
ACBP |
25..109 |
CDD:238248 |
26/72 (36%) |
crotonase-like |
129..326 |
CDD:119339 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23310 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.