DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and Dbi

DIOPT Version :9

Sequence 1:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001033088.1 Gene:Dbi / 13167 MGIID:94865 Length:135 Species:Mus musculus


Alignment Length:80 Identity:29/80 - (36%)
Similarity:45/80 - (56%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66
            |::..|:.|..|..|:.||.|..|.::|||||||.|.:.|.  |.:.||::::|....|.:.:.|
Mouse    54 FDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESA 118

  Fly    67 KAYYI----EVYKKY 77
            ...|:    |:.|||
Mouse   119 MKTYVEKVDELKKKY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 29/80 (36%)
DbiNP_001033088.1 ACBP 52..134 CDD:238248 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.