DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and eci2

DIOPT Version :9

Sequence 1:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_012819853.2 Gene:eci2 / 100216270 XenbaseID:XB-GENE-961246 Length:413 Species:Xenopus tropicalis


Alignment Length:72 Identity:29/72 - (40%)
Similarity:40/72 - (55%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKAGLTADDA 66
            ||:.....|..||.|..|..|:.|..:||||.|.||:.:|.  |...|.:::||||...|..|||
 Frog    63 FEKAQSNLKLLKNDPGNEVKLKLYALFKQATQGPCNVPKPGMLDFVNKVKWDAWKSLGSLPKDDA 127

  Fly    67 KAYYIEV 73
            :..|:|:
 Frog   128 RQSYVEL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 29/72 (40%)
eci2XP_012819853.2 ACBP 60..131 CDD:412233 27/67 (40%)
crotonase-like 161..411 CDD:419961
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.