DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp6 and acbd5b

DIOPT Version :9

Sequence 1:NP_001286963.1 Gene:Acbp6 / 38782 FlyBaseID:FBgn0035743 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_005171195.1 Gene:acbd5b / 100004736 ZFINID:ZDB-GENE-070705-18 Length:425 Species:Danio rerio


Alignment Length:78 Identity:28/78 - (35%)
Similarity:39/78 - (50%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEEIVEKAKNFKNLP-------SKEEFLEFYGYYKQATVGDCNIEEPE--DEEKKARYNAWKSKA 59
            ||..|   |..::||       |.:..:.||.||||||.|.||..:|.  |...||::.|||...
Zfish    16 FEAAV---KVIRSLPEDGSYDLSDDMLVLFYSYYKQATEGPCNTLKPNSWDPIGKAKWEAWKDLG 77

  Fly    60 GLTADDAKAYYIE 72
            .::.|.|...|::
Zfish    78 NMSKDQAMTEYVQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp6NP_001286963.1 ACBP 4..79 CDD:395715 28/78 (36%)
acbd5bXP_005171195.1 ACBP 13..97 CDD:279259 28/78 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.